Recombinant Human NOL10 Protein, GST-tagged
| Cat.No. : | NOL10-5967H |
| Product Overview : | Human NOL10 full-length ORF ( AAH05125.1, 1 a.a. - 688 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NOL10 (Nucleolar Protein 10) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
| Molecular Mass : | 106.7 kDa |
| AA Sequence : | MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQGRYLNPLQTDAAENNVCDINSVHGLFATGTIEGRVECWDPRTRNRVGLLDCALNSVTADSEINSLPTISALKFNGALTMAVGTTTGQVLLYDLRSDKPLLVKDHQYGLPIKSVHFQDSLDLILSADSRIVKMWNKNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVKLMVNPFAYEEYRKDKIRQKIEETRAQRVQLKKLPKVNKELALKLIEEEEEKQKSTWKKKVKSLPNILTDDRFKVMFENPDFQVDEESEEFRLLNPLVSKISEKRKKKLRLLEQQELREKEEEEEPEGKPSDAESSESSDDEKAWVEEVRKQRRLLQQEEKVKRQERLKEDQQTVLKPQFYEIKAGEEFRSFKDSATKQKLMNKTLEDRLKIEAKNGTLSVSDTTVGSKQLTFTLKRSEQQKKQQEAEKLHRQERKRLRRSAGHLKSRHKRGRSFH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NOL10 nucleolar protein 10 [ Homo sapiens ] |
| Official Symbol | NOL10 |
| Synonyms | NOL10; nucleolar protein 10; polyglutamine binding protein 5 , PQBP5; FLJ14075; H_NH0074G24.1; polyglutamine binding protein 5; PQBP5; FLJ13938; |
| Gene ID | 79954 |
| mRNA Refseq | NM_024894 |
| Protein Refseq | NP_079170 |
| UniProt ID | Q9BSC4 |
| ◆ Recombinant Proteins | ||
| NOL10-3675R | Recombinant Rat NOL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOL10-10577Z | Recombinant Zebrafish NOL10 | +Inquiry |
| NOL10-5967H | Recombinant Human NOL10 Protein, GST-tagged | +Inquiry |
| NOL10-6682HF | Recombinant Full Length Human NOL10 Protein, GST-tagged | +Inquiry |
| NOL10-4016R | Recombinant Rat NOL10 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOL10-3770HCL | Recombinant Human NOL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL10 Products
Required fields are marked with *
My Review for All NOL10 Products
Required fields are marked with *
