Recombinant Human NOL3 protein, His-SUMO-tagged
Cat.No. : | NOL3-3281H |
Product Overview : | Recombinant Human NOL3 protein(O60936)(1-208aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-208aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
Official Symbol | NOL3 |
Synonyms | NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304; |
Gene ID | 8996 |
mRNA Refseq | NM_001185057 |
Protein Refseq | NP_001171986 |
MIM | 605235 |
UniProt ID | O60936 |
◆ Recombinant Proteins | ||
NOL3-5971H | Recombinant Human NOL3 Protein, GST-tagged | +Inquiry |
NOL3-3483H | Recombinant Human NOL3 protein, MYC/DDK-tagged | +Inquiry |
Nol3-1835M | Recombinant Mouse Nol3 Protein, His-tagged | +Inquiry |
NOL3-3677R | Recombinant Rat NOL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOL3-3281H | Recombinant Human NOL3 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *