Recombinant Human NOL3 protein, His-tagged
Cat.No. : | NOL3-48H |
Product Overview : | Recombinant Human NOL3 (Met1-Ser208) fussed with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-208 a.a. |
Description : | Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. |
Form : | Supplied as a 0.2 μm filtered solution of 25mM Tris-HCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5 |
AA Sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLV QGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRA SDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEP EPDFEERDESEDS |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
Official Symbol | NOL3 |
Synonyms | ARC; FCM; MYP; NOP; NOP30; nucleolar protein 3; muscle-enriched cytoplasmic protein; nucleolar protein of 30 kDa |
Gene ID | 8996 |
mRNA Refseq | NM_001185057 |
Protein Refseq | NP_001171986 |
MIM | 605235 |
UniProt ID | O60936 |
Chromosome Location | 16q22.1 |
Function | RNA binding; calcium ion binding; caspase binding |
◆ Recombinant Proteins | ||
NOL3-4018R | Recombinant Rat NOL3 Protein | +Inquiry |
Nol3-1835M | Recombinant Mouse Nol3 Protein, His-tagged | +Inquiry |
NOL3-3483H | Recombinant Human NOL3 protein, MYC/DDK-tagged | +Inquiry |
NOL3-3677R | Recombinant Rat NOL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOL3-48H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *
0
Inquiry Basket