Recombinant Human NOL4L protein, GST-tagged
Cat.No. : | NOL4L-7343H |
Product Overview : | Recombinant Human NOL4L protein(40-166 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 40-166 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD |
Gene Name | NOL4L nucleolar protein 4 like [ Homo sapiens (human) ] |
Official Symbol | NOL4L |
Synonyms | C20orf112; C20orf113; NOL4L |
Gene ID | 140688 |
mRNA Refseq | NM_001256798 |
Protein Refseq | NP_001243727 |
MIM | 618893 |
◆ Recombinant Proteins | ||
NOL4L-7344H | Recombinant Human NOL4L protein, His-tagged | +Inquiry |
NOL4L-7343H | Recombinant Human NOL4L protein, GST-tagged | +Inquiry |
NOL4L-3150H | Recombinant Human NOL4L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nol4l-4455M | Recombinant Mouse Nol4l Protein, Myc/DDK-tagged | +Inquiry |
NOL4L-1160H | Recombinant Human NOL4L Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL4L Products
Required fields are marked with *
My Review for All NOL4L Products
Required fields are marked with *