Recombinant Human NOL6 Protein, GST-tagged
Cat.No. : | NOL6-5975H |
Product Overview : | Human NOL6 full-length ORF ( AAH08298, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq |
Molecular Mass : | 47.74 kDa |
AA Sequence : | MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOL6 nucleolar protein 6 (RNA-associated) [ Homo sapiens(human) ] |
Official Symbol | NOL6 |
Synonyms | NOL6; NRAP; UTP22; bA311H10.1; nucleolar protein 6 (RNA-associated); nucleolar protein 6; nucleolar RNA-associated protein; nucleolar protein family 6 (RNA-associated) |
Gene ID | 65083 |
mRNA Refseq | NM_022917 |
Protein Refseq | NP_075068 |
MIM | 611532 |
UniProt ID | Q9H6R4 |
◆ Recombinant Proteins | ||
NOL6-6695HF | Recombinant Full Length Human NOL6 Protein, GST-tagged | +Inquiry |
NOL6-5975H | Recombinant Human NOL6 Protein, GST-tagged | +Inquiry |
NOL6-7510Z | Recombinant Zebrafish NOL6 | +Inquiry |
NOL6-6129M | Recombinant Mouse NOL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOL6-1327H | Recombinant Human NOL6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL6-1202HCL | Recombinant Human NOL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOL6 Products
Required fields are marked with *
My Review for All NOL6 Products
Required fields are marked with *
0
Inquiry Basket