Recombinant Human NOL6 protein, His-tagged
| Cat.No. : | NOL6-1327H |
| Product Overview : | Recombinant Human NOL6 protein(947-1146 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 947-1146 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NOL6 nucleolar protein 6 (RNA-associated) [ Homo sapiens(human) ] |
| Official Symbol | NOL6 |
| Synonyms | NOL6; NRAP; UTP22; bA311H10.1; nucleolar protein 6 (RNA-associated); nucleolar protein 6; nucleolar RNA-associated protein; nucleolar protein family 6 (RNA-associated) |
| Gene ID | 65083 |
| mRNA Refseq | NM_022917 |
| Protein Refseq | NP_075068 |
| MIM | 611532 |
| UniProt ID | Q9H6R4 |
| ◆ Recombinant Proteins | ||
| NOL6-7510Z | Recombinant Zebrafish NOL6 | +Inquiry |
| NOL6-6129M | Recombinant Mouse NOL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOL6-1327H | Recombinant Human NOL6 protein, His-tagged | +Inquiry |
| NOL6-10774M | Recombinant Mouse NOL6 Protein | +Inquiry |
| NOL6-5975H | Recombinant Human NOL6 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOL6-1202HCL | Recombinant Human NOL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL6 Products
Required fields are marked with *
My Review for All NOL6 Products
Required fields are marked with *
