Recombinant Human NOMO3 Protein, GST-tagged
Cat.No. : | NOMO3-5985H |
Product Overview : | Human NOMO3 partial ORF ( NP_001004067.1, 966 a.a. - 1033 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum. [provided by RefSeq |
Molecular Mass : | 33.22 kDa |
AA Sequence : | TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOMO3 NODAL modulator 3 [ Homo sapiens (human) ] |
Official Symbol | NOMO3 |
Synonyms | NOMO3; NODAL modulator 3; Nomo; nodal modulator 3; pM5 protein 3; pM5 protein, middle copy |
Gene ID | 408050 |
mRNA Refseq | NM_001004067 |
Protein Refseq | NP_001004067 |
MIM | 609159 |
UniProt ID | P69849 |
◆ Recombinant Proteins | ||
NOMO3-922H | Recombinant Human NOMO3 | +Inquiry |
NOMO3-1159H | Recombinant Human NOMO3 Protein, MYC/DDK-tagged | +Inquiry |
NOMO3-3650H | Recombinant Human NOMO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOMO3-5985H | Recombinant Human NOMO3 Protein, GST-tagged | +Inquiry |
NOMO3-1656H | Recombinant Human NOMO3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOMO3 Products
Required fields are marked with *
My Review for All NOMO3 Products
Required fields are marked with *