Recombinant Human NOMO3 Protein, GST-tagged

Cat.No. : NOMO3-5985H
Product Overview : Human NOMO3 partial ORF ( NP_001004067.1, 966 a.a. - 1033 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum. [provided by RefSeq
Molecular Mass : 33.22 kDa
AA Sequence : TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOMO3 NODAL modulator 3 [ Homo sapiens (human) ]
Official Symbol NOMO3
Synonyms NOMO3; NODAL modulator 3; Nomo; nodal modulator 3; pM5 protein 3; pM5 protein, middle copy
Gene ID 408050
mRNA Refseq NM_001004067
Protein Refseq NP_001004067
MIM 609159
UniProt ID P69849

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOMO3 Products

Required fields are marked with *

My Review for All NOMO3 Products

Required fields are marked with *

0
cart-icon
0
compare icon