"NONO" Related Products

Expand
Expand
Expand

Recombinant Human NONO protein, GST-tagged

Cat.No.: NONO-854H
Product Overview: Recombinant Human NONO(101 a.a. - 210 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: GEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE RAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
Official Symbol: NONO
Synonyms: NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein;
Gene ID: 4841
mRNA Refseq: NM_007363
Protein Refseq: NP_031389
MIM: 300084
UniProt ID: Q15233
Chromosome Location: Xq13.1
Pathway: Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function: DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.