Recombinant Human NONO protein, GST-tagged
Cat.No. : | NONO-854H |
Product Overview : | Recombinant Human NONO(101 a.a. - 210 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 101-210 a.a. |
Description : | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE RAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NONO non-POU domain containing, octamer-binding [ Homo sapiens ] |
Official Symbol | NONO |
Synonyms | NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein; |
Gene ID | 4841 |
mRNA Refseq | NM_007363 |
Protein Refseq | NP_031389 |
MIM | 300084 |
UniProt ID | Q15233 |
Chromosome Location | Xq13.1 |
Pathway | Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem; |
Function | DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
NONO-854H | Recombinant Human NONO protein, GST-tagged | +Inquiry |
NONO-28748TH | Recombinant Human NONO, His-tagged | +Inquiry |
NONO-2885R | Recombinant Rhesus Macaque NONO Protein, His (Fc)-Avi-tagged | +Inquiry |
NONO-2496H | Recombinant Human NONO Protein, His-tagged | +Inquiry |
NONO-2684HFL | Recombinant Full Length Human NONO protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NONO-3766HCL | Recombinant Human NONO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NONO Products
Required fields are marked with *
My Review for All NONO Products
Required fields are marked with *