Recombinant Human NONO protein, GST-tagged NONO-854H

Recombinant Human NONO protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NONO protein, GST-tagged

Recombinant Human NONO protein, GST-tagged

NONO Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NONO-854H
Product Overview : Recombinant Human NONO(101 a.a. - 210 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : GEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE RAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
Official Symbol : NONO
Synonyms : NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein;
Gene ID : 4841
mRNA Refseq : NM_007363
Protein Refseq : NP_031389
MIM : 300084
UniProt ID : Q15233
Chromosome Location : Xq13.1
Pathway : Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function : DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy