Recombinant Human NONO Protein, His tagged, Avi-Biotinylated
| Cat.No. : | NONO-2496HB |
| Product Overview : | Avi-Biotinylated recombinant Human NONO Protein with His-tag was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. |
| Molecular Mass : | The protein has a calculated MW of 26 kDa. |
| AA Sequence : | MHHHHHHGLNDIFEAQKIEWHEKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMD |
| Endotoxin : | < 10 EU/μg by LAL |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.15 mg/mL |
| Storage Buffer : | Sterile 50mM Tris, pH7.5, 300mM NaCl, 10% Glycerol |
| Conjugation : | Biotin |
| Gene Name | NONO non-POU domain containing, octamer-binding [ Homo sapiens (human) ] |
| Official Symbol | NONO |
| Synonyms | NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein; |
| Gene ID | 4841 |
| mRNA Refseq | NM_001145408 |
| Protein Refseq | NP_001138880 |
| MIM | 300084 |
| UniProt ID | Q15233 |
| ◆ Recombinant Proteins | ||
| NONO-691H | Recombinant Human NONO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NONO-11561Z | Recombinant Zebrafish NONO | +Inquiry |
| NONO-2496H | Recombinant Human NONO Protein, His-tagged | +Inquiry |
| NONO-851H | Recombinant Human NONO protein, MYC/DDK-tagged | +Inquiry |
| NONO-2496HB | Recombinant Human NONO Protein, His tagged, Avi-Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NONO-3766HCL | Recombinant Human NONO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NONO Products
Required fields are marked with *
My Review for All NONO Products
Required fields are marked with *



