Recombinant Human NONO Protein, His tagged, Avi-Biotinylated
Cat.No. : | NONO-2496HB |
Product Overview : | Avi-Biotinylated recombinant Human NONO Protein with His-tag was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. |
Molecular Mass : | The protein has a calculated MW of 26 kDa. |
AA Sequence : | MHHHHHHGLNDIFEAQKIEWHEKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMD |
Endotoxin : | < 10 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.15 mg/mL |
Storage Buffer : | Sterile 50mM Tris, pH7.5, 300mM NaCl, 10% Glycerol |
Conjugation : | Biotin |
Gene Name | NONO non-POU domain containing, octamer-binding [ Homo sapiens (human) ] |
Official Symbol | NONO |
Synonyms | NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein; |
Gene ID | 4841 |
mRNA Refseq | NM_001145408 |
Protein Refseq | NP_001138880 |
MIM | 300084 |
UniProt ID | Q15233 |
◆ Recombinant Proteins | ||
NONO-3066R | Recombinant Rhesus monkey NONO Protein, His-tagged | +Inquiry |
NONO-1332H | Recombinant Human NONO protein, His-sumo-tagged | +Inquiry |
NONO-854H | Recombinant Human NONO protein, GST-tagged | +Inquiry |
NONO-4445H | Recombinant Human NONO protein, His-tagged | +Inquiry |
NONO-3176C | Recombinant Chicken NONO | +Inquiry |
◆ Cell & Tissue Lysates | ||
NONO-3766HCL | Recombinant Human NONO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NONO Products
Required fields are marked with *
My Review for All NONO Products
Required fields are marked with *