Recombinant Human NOP56, His-tagged
| Cat.No. : | NOP56-29657TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 235-594 of Human NOL5A with N terminal His tag; Predicted MWt 41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 235-594 a.a. |
| Description : | Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 67 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSL SEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHA GSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGL IFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPT SVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQA EEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSS STPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETV NDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSK KKKKFHKASQED |
| Gene Name | NOP56 NOP56 ribonucleoprotein homolog (yeast) [ Homo sapiens ] |
| Official Symbol | NOP56 |
| Synonyms | NOP56; NOP56 ribonucleoprotein homolog (yeast); NOL5A, nucleolar protein 5A (56kD with KKE/D repeat) , nucleolar protein 5A (56kDa with KKE/D repeat); nucleolar protein 56; SCA36; spinocerebellar ataxia 36; |
| Gene ID | 10528 |
| mRNA Refseq | NM_006392 |
| Protein Refseq | NP_006383 |
| MIM | 614154 |
| Uniprot ID | O00567 |
| Chromosome Location | 20p13 |
| Pathway | Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; |
| Function | RNA binding; protein binding; snoRNA binding; |
| ◆ Recombinant Proteins | ||
| NOP56-11429Z | Recombinant Zebrafish NOP56 | +Inquiry |
| NOP56-751C | Recombinant Cynomolgus NOP56 Protein, His-tagged | +Inquiry |
| NOP56-495C | Recombinant Cynomolgus Monkey NOP56 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOP56-6694HF | Recombinant Full Length Human NOP56 Protein, GST-tagged | +Inquiry |
| NOP56-1213H | Recombinant Human NOP56 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOP56-3763HCL | Recombinant Human NOP56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOP56 Products
Required fields are marked with *
My Review for All NOP56 Products
Required fields are marked with *
