Recombinant Human NOTCH1 protein(2428-2555aa), His-GST&Myc-tagged
| Cat.No. : | NOTCH1-9118H |
| Product Overview : | Recombinant Human NOTCH1 protein(P46531)(2428-2555aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 2428-2555aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
| Gene Name | NOTCH1 notch 1 [ Homo sapiens ] |
| Official Symbol | NOTCH1 |
| Synonyms | NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1; Notch homolog 1, translocation-associated; translocation-associated notch protein TAN-1; hN1; TAN1; |
| Gene ID | 4851 |
| mRNA Refseq | NM_017617 |
| Protein Refseq | NP_060087 |
| MIM | 190198 |
| UniProt ID | P46531 |
| ◆ Recombinant Proteins | ||
| NOTCH1-385H | Recombinant Human NOTCH1 protein, His-tagged | +Inquiry |
| Notch1-2540R | Recombinant Rat Notch1, Fc Chimera | +Inquiry |
| Notch1-420M | Recombinant Mouse Notch1 protein, GST-tagged | +Inquiry |
| NOTCH1-127H | Recombinant Human NOTCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Notch1-13R | Recombinant Rat Notch1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOTCH1-469MCL | Recombinant Mouse NOTCH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOTCH1 Products
Required fields are marked with *
My Review for All NOTCH1 Products
Required fields are marked with *



