Recombinant Human NOTCH2NL Protein, GST-tagged

Cat.No. : NOTCH2NL-5998H
Product Overview : Human NOTCH2NL full-length ORF ( AAH19835, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NOTCH2NL (Notch 2 N-Terminal Like) is a Protein Coding gene. Among its related pathways are Notch Signaling Pathway (sino). GO annotations related to this gene include calcium ion binding. An important paralog of this gene is NOTCH2.
Molecular Mass : 51.7 kDa
AA Sequence : MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOTCH2NL notch 2 N-terminal like [ Homo sapiens ]
Official Symbol NOTCH2NL
Synonyms NOTCH2NL; notch 2 N-terminal like; Notch homolog 2 (Drosophila) N terminal like; notch homolog 2 N-terminal-like protein; N2N; Notch homolog 2 N-terminal like protein; FLJ35032; FLJ55807;
Gene ID 388677
mRNA Refseq NM_203458
Protein Refseq NP_982283
UniProt ID Q7Z3S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOTCH2NL Products

Required fields are marked with *

My Review for All NOTCH2NL Products

Required fields are marked with *

0
cart-icon