Recombinant Human NOTCH2NL Protein, GST-tagged
Cat.No. : | NOTCH2NL-5998H |
Product Overview : | Human NOTCH2NL full-length ORF ( AAH19835, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NOTCH2NL (Notch 2 N-Terminal Like) is a Protein Coding gene. Among its related pathways are Notch Signaling Pathway (sino). GO annotations related to this gene include calcium ion binding. An important paralog of this gene is NOTCH2. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOTCH2NL notch 2 N-terminal like [ Homo sapiens ] |
Official Symbol | NOTCH2NL |
Synonyms | NOTCH2NL; notch 2 N-terminal like; Notch homolog 2 (Drosophila) N terminal like; notch homolog 2 N-terminal-like protein; N2N; Notch homolog 2 N-terminal like protein; FLJ35032; FLJ55807; |
Gene ID | 388677 |
mRNA Refseq | NM_203458 |
Protein Refseq | NP_982283 |
UniProt ID | Q7Z3S9 |
◆ Recombinant Proteins | ||
NOTCH2NL-505H | Recombinant Human NOTCH2NL Protein, Fc-tagged | +Inquiry |
NOTCH2NL-6718HF | Recombinant Full Length Human NOTCH2NL Protein, GST-tagged | +Inquiry |
NOTCH2NL-1601H | Recombinant Human NOTCH2NL protein, His & T7-tagged | +Inquiry |
NOTCH2NL-5998H | Recombinant Human NOTCH2NL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTCH2NL-3755HCL | Recombinant Human NOTCH2NL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOTCH2NL Products
Required fields are marked with *
My Review for All NOTCH2NL Products
Required fields are marked with *