Recombinant Human NOX1 Full Length Transmembrane protein, His-tagged

Cat.No. : NOX1-1329H
Product Overview : Recombinant Human NOX1 protein(Q9Y5S8)(1-564aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-564aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 67.7 kDa
AA Sequence : MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NOX1 NADPH oxidase 1 [ Homo sapiens ]
Official Symbol NOX1
Synonyms NOX1; NADPH oxidase 1; GP91 2; mitogenic oxidase (pyridine nucleotide dependent superoxide generating); MOX1; NADPH oxidase 1 variant NOH 1L; NADPH oxidase homolog 1; NOH 1; NOH1; MOX-1; NOX-1; mitogenic oxidase 1; NADPH oxidase homolog-1; NADPH oxidase 1 variant NOH-1L; NADH/NADPH mitogenic oxidase subunit P65-MOX; mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating); NOH-1; GP91-2;
Gene ID 27035
mRNA Refseq NM_007052
Protein Refseq NP_008983
MIM 300225
UniProt ID Q9Y5S8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOX1 Products

Required fields are marked with *

My Review for All NOX1 Products

Required fields are marked with *

0
cart-icon