Recombinant Human NOX4
Cat.No. : | NOX4-29711TH |
Product Overview : | Recombinant fragment corresponding to aa 479-578 of human NOX4 with a proprietary tag; 36.63kDa inclusive of tag; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain t |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced. |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS |
Sequence Similarities : | Contains 1 FAD-binding FR-type domain.Contains 1 ferric oxidoreductase domain. |
Gene Name | NOX4 NADPH oxidase 4 [ Homo sapiens ] |
Official Symbol | NOX4 |
Synonyms | NOX4; NADPH oxidase 4; KOX; KOX 1; |
Gene ID | 50507 |
mRNA Refseq | NM_001143836 |
Protein Refseq | NP_001137308 |
MIM | 605261 |
Uniprot ID | Q9NPH5 |
Chromosome Location | 11q14.2-q21 |
Pathway | Oxidative Stress, organism-specific biosystem; Signaling events mediated by PTP1B, organism-specific biosystem; |
Function | NAD(P)H oxidase activity; electron carrier activity; flavin adenine dinucleotide binding; heme binding; nucleotide binding; |
◆ Recombinant Proteins | ||
NOX4-1977H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
NOX4-3282H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
RFL35916PF | Recombinant Full Length Pongo Abelii Nadph Oxidase 4(Nox4) Protein, His-Tagged | +Inquiry |
NOX4-1328S | Recombinant Sumatran orangutan NOX4 Full Length Transmembrane protein, His-tagged | +Inquiry |
Nox4-1840M | Recombinant Mouse Nox4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
0
Inquiry Basket