Recombinant Human NOXO1 Protein, GST-tagged

Cat.No. : NOXO1-6011H
Product Overview : Human NOXO1 partial ORF ( AAH15917, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators (see NOXA1; MIM 611255) to NOX and also target NOX to different subcellular compartments (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOXO1 NADPH oxidase organizer 1 [ Homo sapiens ]
Official Symbol NOXO1
Synonyms NOXO1; NADPH oxidase organizer 1; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28; Nox organizer 1; nox-organizing protein 1; regulatory protein P41NOX; NADPH oxidase regulatory protein; SH3 and PX domain-containing protein 5; P41NOX; MGC20258;
Gene ID 124056
mRNA Refseq NM_144603
Protein Refseq NP_653204
MIM 611256
UniProt ID Q8NFA2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOXO1 Products

Required fields are marked with *

My Review for All NOXO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon