Recombinant Human NOXO1 Protein, GST-tagged
Cat.No. : | NOXO1-6011H |
Product Overview : | Human NOXO1 partial ORF ( AAH15917, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators (see NOXA1; MIM 611255) to NOX and also target NOX to different subcellular compartments (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOXO1 NADPH oxidase organizer 1 [ Homo sapiens ] |
Official Symbol | NOXO1 |
Synonyms | NOXO1; NADPH oxidase organizer 1; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28; Nox organizer 1; nox-organizing protein 1; regulatory protein P41NOX; NADPH oxidase regulatory protein; SH3 and PX domain-containing protein 5; P41NOX; MGC20258; |
Gene ID | 124056 |
mRNA Refseq | NM_144603 |
Protein Refseq | NP_653204 |
MIM | 611256 |
UniProt ID | Q8NFA2 |
◆ Recombinant Proteins | ||
Noxo1-4468M | Recombinant Mouse Noxo1 Protein, Myc/DDK-tagged | +Inquiry |
NOXO1-681H | Recombinant Human NOXO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NOXO1-6149M | Recombinant Mouse NOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOXO1-6011H | Recombinant Human NOXO1 Protein, GST-tagged | +Inquiry |
NOXO1-10801M | Recombinant Mouse NOXO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOXO1-3748HCL | Recombinant Human NOXO1 293 Cell Lysate | +Inquiry |
NOXO1-3747HCL | Recombinant Human NOXO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOXO1 Products
Required fields are marked with *
My Review for All NOXO1 Products
Required fields are marked with *
0
Inquiry Basket