Recombinant Human NPDC1 Protein, HIS-tagged

Cat.No. : NPDC1-049H
Product Overview : Recombinant Human NPDC1 fused with His tag at C-termina was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Form : Lyophilized from a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0
Molecular Mass : 16.5kD
AA Sequence : GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : >50 ug/mL as determined by microplate BCA method
Gene Name NPDC1 neural proliferation, differentiation and control, 1 [ Homo sapiens ]
Official Symbol NPDC1
Synonyms CAB; CAB-; CAB1; CAB-1; NPDC-1
Gene ID 56654
mRNA Refseq NM_015392.3
Protein Refseq NP_056207
MIM 605798
UniProt ID Q9NQX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPDC1 Products

Required fields are marked with *

My Review for All NPDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon