Recombinant Human NPDC1 Protein, HIS-tagged
Cat.No. : | NPDC1-049H |
Product Overview : | Recombinant Human NPDC1 fused with His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0 |
Molecular Mass : | 16.5kD |
AA Sequence : | GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Gene Name | NPDC1 neural proliferation, differentiation and control, 1 [ Homo sapiens ] |
Official Symbol | NPDC1 |
Synonyms | CAB; CAB-; CAB1; CAB-1; NPDC-1 |
Gene ID | 56654 |
mRNA Refseq | NM_015392.3 |
Protein Refseq | NP_056207 |
MIM | 605798 |
UniProt ID | Q9NQX5 |
◆ Recombinant Proteins | ||
NPDC1-5025H | Recombinant Human NPDC1 Protein (Gly35-Asp181), C-His tagged | +Inquiry |
NPDC1-6154M | Recombinant Mouse NPDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPDC1-1271H | Recombinant Human NPDC1 Protein, MYC/DDK-tagged | +Inquiry |
NPDC1-10813M | Recombinant Mouse NPDC1 Protein | +Inquiry |
NPDC1-935H | Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPDC1 Products
Required fields are marked with *
My Review for All NPDC1 Products
Required fields are marked with *
0
Inquiry Basket