Recombinant Human NPDC1 Protein, HIS-tagged

• Cat.No.: NPDC1-049H
• Product Overview: Recombinant Human NPDC1 fused with His tag at C-termina was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0
• Molecular Mass: 16.5kD
• AA Sequence: GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >50 ug/mL as determined by microplate BCA method

Gene Information

• Gene Name: NPDC1 neural proliferation, differentiation and control, 1 [ Homo sapiens ]
• Official Symbol: NPDC1
• Synonyms: CAB; CAB-; CAB1; CAB-1; NPDC-1
• Gene ID: 56654
• mRNA Refseq: NM_015392.3
• Protein Refseq: NP_056207
• MIM: 605798
• UniProt ID: Q9NQX5