Recombinant Human NPDC1 Protein, HIS-tagged
| Cat.No. : | NPDC1-049H |
| Product Overview : | Recombinant Human NPDC1 fused with His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0 |
| Molecular Mass : | 16.5kD |
| AA Sequence : | GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | >50 ug/mL as determined by microplate BCA method |
| Gene Name | NPDC1 neural proliferation, differentiation and control, 1 [ Homo sapiens ] |
| Official Symbol | NPDC1 |
| Synonyms | CAB; CAB-; CAB1; CAB-1; NPDC-1 |
| Gene ID | 56654 |
| mRNA Refseq | NM_015392.3 |
| Protein Refseq | NP_056207 |
| MIM | 605798 |
| UniProt ID | Q9NQX5 |
| ◆ Recombinant Proteins | ||
| NPDC1-1271H | Recombinant Human NPDC1 Protein, MYC/DDK-tagged | +Inquiry |
| NPDC1-352H | Recombinant Human NPDC1 protein, His-tagged | +Inquiry |
| NPDC1-049H | Recombinant Human NPDC1 Protein, HIS-tagged | +Inquiry |
| NPDC1-5025H | Recombinant Human NPDC1 Protein (Gly35-Asp181), C-His tagged | +Inquiry |
| Npdc1-4469M | Recombinant Mouse Npdc1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPDC1 Products
Required fields are marked with *
My Review for All NPDC1 Products
Required fields are marked with *



