Recombinant Human NPEPPS protein(71-150 aa), C-His-tagged
Cat.No. : | NPEPPS-2789H |
Product Overview : | Recombinant Human NPEPPS protein(P55786)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVG |
Gene Name | NPEPPS aminopeptidase puromycin sensitive [ Homo sapiens ] |
Official Symbol | NPEPPS |
Synonyms | NPEPPS; aminopeptidase puromycin sensitive; puromycin-sensitive aminopeptidase; metalloproteinase MP100; MP100; PSA; puromycin sensitive aminopeptidase; cytosol alanyl aminopeptidase; AAP-S; |
Gene ID | 9520 |
mRNA Refseq | NM_006310 |
Protein Refseq | NP_006301 |
MIM | 606793 |
UniProt ID | P55786 |
◆ Recombinant Proteins | ||
NPEPPS-6023H | Recombinant Human NPEPPS Protein, GST-tagged | +Inquiry |
NPEPPS-2789H | Recombinant Human NPEPPS protein(71-150 aa), C-His-tagged | +Inquiry |
NPEPPS-3284H | Recombinant Human NPEPPS protein, His-tagged | +Inquiry |
NPEPPS-2245H | Recombinant Human NPEPPS protein, His&Myc-tagged | +Inquiry |
NPEPPS-1158H | Recombinant Human NPEPPS protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPEPPS Products
Required fields are marked with *
My Review for All NPEPPS Products
Required fields are marked with *
0
Inquiry Basket