Recombinant Human NPEPPS protein(71-150 aa), C-His-tagged

• Cat.No.: NPEPPS-2789H
• Product Overview: Recombinant Human NPEPPS protein(P55786)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 71-150 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVG

Gene Information

• Gene Name: NPEPPS aminopeptidase puromycin sensitive [ Homo sapiens ]
• Official Symbol: NPEPPS
• Synonyms: NPEPPS; aminopeptidase puromycin sensitive; puromycin-sensitive aminopeptidase; metalloproteinase MP100; MP100; PSA; puromycin sensitive aminopeptidase; cytosol alanyl aminopeptidase; AAP-S
• Gene ID: 9520
• mRNA Refseq: NM_006310
• Protein Refseq: NP_006301
• MIM: 606793
• UniProt ID: P55786