Recombinant Human NPEPPS Protein, GST-tagged
Cat.No. : | NPEPPS-6023H |
Product Overview : | Human NPEPPS partial ORF ( NP_006301.2, 776 a.a. - 875 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPEPPS aminopeptidase puromycin sensitive [ Homo sapiens ] |
Official Symbol | NPEPPS |
Synonyms | NPEPPS; aminopeptidase puromycin sensitive; puromycin-sensitive aminopeptidase; metalloproteinase MP100; MP100; PSA; puromycin sensitive aminopeptidase; cytosol alanyl aminopeptidase; AAP-S; |
Gene ID | 9520 |
mRNA Refseq | NM_006310 |
Protein Refseq | NP_006301 |
MIM | 606793 |
UniProt ID | P55786 |
◆ Recombinant Proteins | ||
NPEPPS-1158H | Recombinant Human NPEPPS protein, His-tagged | +Inquiry |
NPEPPS-10815M | Recombinant Mouse NPEPPS Protein | +Inquiry |
NPEPPS-3284H | Recombinant Human NPEPPS protein, His-tagged | +Inquiry |
NPEPPS-6023H | Recombinant Human NPEPPS Protein, GST-tagged | +Inquiry |
NPEPPS-7569Z | Recombinant Zebrafish NPEPPS | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPEPPS Products
Required fields are marked with *
My Review for All NPEPPS Products
Required fields are marked with *
0
Inquiry Basket