Recombinant Human NPEPPS Protein, GST-tagged

Cat.No. : NPEPPS-6023H
Product Overview : Human NPEPPS partial ORF ( NP_006301.2, 776 a.a. - 875 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : SKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPEPPS aminopeptidase puromycin sensitive [ Homo sapiens ]
Official Symbol NPEPPS
Synonyms NPEPPS; aminopeptidase puromycin sensitive; puromycin-sensitive aminopeptidase; metalloproteinase MP100; MP100; PSA; puromycin sensitive aminopeptidase; cytosol alanyl aminopeptidase; AAP-S;
Gene ID 9520
mRNA Refseq NM_006310
Protein Refseq NP_006301
MIM 606793
UniProt ID P55786

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPEPPS Products

Required fields are marked with *

My Review for All NPEPPS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon