Recombinant Human NPHP4 Protein, GST-tagged

Cat.No. : NPHP4-6029H
Product Overview : Human NPHP4 full-length ORF ( AAH50076.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq
Molecular Mass : 34.9 kDa
AA Sequence : MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPHP4 nephronophthisis 4 [ Homo sapiens ]
Official Symbol NPHP4
Synonyms NPHP4; nephronophthisis 4; nephrocystin-4; KIAA0673; nephrocystin 4; nephroretinin; POC10; POC10 centriolar protein homolog (Chlamydomonas); SLSN4; POC10 centriolar protein homolog; FLJ46306;
Gene ID 261734
mRNA Refseq NM_015102
Protein Refseq NP_055917
MIM 607215
UniProt ID O75161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHP4 Products

Required fields are marked with *

My Review for All NPHP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon