Recombinant Human NPHP4 Protein, GST-tagged
| Cat.No. : | NPHP4-6029H | 
| Product Overview : | Human NPHP4 full-length ORF ( AAH50076.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq | 
| Molecular Mass : | 34.9 kDa | 
| AA Sequence : | MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | NPHP4 nephronophthisis 4 [ Homo sapiens ] | 
| Official Symbol | NPHP4 | 
| Synonyms | NPHP4; nephronophthisis 4; nephrocystin-4; KIAA0673; nephrocystin 4; nephroretinin; POC10; POC10 centriolar protein homolog (Chlamydomonas); SLSN4; POC10 centriolar protein homolog; FLJ46306; | 
| Gene ID | 261734 | 
| mRNA Refseq | NM_015102 | 
| Protein Refseq | NP_055917 | 
| MIM | 607215 | 
| UniProt ID | O75161 | 
| ◆ Recombinant Proteins | ||
| NPHP4-6159M | Recombinant Mouse NPHP4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Nphp4-6759M | Recombinant Mouse Nphp4 Protein (Gly760-Gln1425), C-His tagged | +Inquiry | 
| NPHP4-6622HF | Recombinant Full Length Human NPHP4 Protein, GST-tagged | +Inquiry | 
| Nphp4-6758M | Recombinant Mouse Nphp4 Protein (Met1-Gly478), C-His tagged | +Inquiry | 
| NPHP4-10821M | Recombinant Mouse NPHP4 Protein | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHP4 Products
Required fields are marked with *
My Review for All NPHP4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            