Recombinant Human NPHS1 Protein, GST-tagged
Cat.No. : | NPHS1-6031H |
Product Overview : | Human NPHS1 partial ORF ( NP_004637.1, 33 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nephrin is a kidney glomerular filtration barrier protein that is an essential component of the interpodocyte-spanning slit diaphragm. Mutations in the nephrin gene are associated with congenital nephrotic syndrome (NPHS1; MIM 256300).[supplied by OMIM |
Molecular Mass : | 35.64 kDa |
AA Sequence : | GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ] |
Official Symbol | NPHS1 |
Synonyms | NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor; |
Gene ID | 4868 |
mRNA Refseq | NM_004646 |
Protein Refseq | NP_004637 |
MIM | 602716 |
UniProt ID | O60500 |
◆ Recombinant Proteins | ||
NPHS1-5640H | Recombinant Human NPHS1 protein, His & T7-tagged | +Inquiry |
Nphs1-5641M | Recombinant Mouse Nphs1 protein, His-tagged | +Inquiry |
NPHS1-3815Z | Recombinant Zebrafish NPHS1 | +Inquiry |
NPHS1-1843H | Recombinant Human NPHS1 Protein, His&GST-tagged | +Inquiry |
Nphs1-1343M | Recombinant Mouse Nphs1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHS1 Products
Required fields are marked with *
My Review for All NPHS1 Products
Required fields are marked with *
0
Inquiry Basket