Recombinant Human NPHS1 Protein, GST-tagged

• Cat.No.: NPHS1-6031H
• Product Overview: Human NPHS1 partial ORF ( NP_004637.1, 33 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Nephrin is a kidney glomerular filtration barrier protein that is an essential component of the interpodocyte-spanning slit diaphragm. Mutations in the nephrin gene are associated with congenital nephrotic syndrome (NPHS1; MIM 256300).[supplied by OMIM
• Molecular Mass: 35.64 kDa
• AA Sequence: GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
• Official Symbol: NPHS1
• Synonyms: NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor
• Gene ID: 4868
• mRNA Refseq: NM_004646
• Protein Refseq: NP_004637
• MIM: 602716
• UniProt ID: O60500