Recombinant Human NPHS1 Protein, GST-tagged

Cat.No. : NPHS1-6031H
Product Overview : Human NPHS1 partial ORF ( NP_004637.1, 33 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Nephrin is a kidney glomerular filtration barrier protein that is an essential component of the interpodocyte-spanning slit diaphragm. Mutations in the nephrin gene are associated with congenital nephrotic syndrome (NPHS1; MIM 256300).[supplied by OMIM
Molecular Mass : 35.64 kDa
AA Sequence : GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
Official Symbol NPHS1
Synonyms NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor;
Gene ID 4868
mRNA Refseq NM_004646
Protein Refseq NP_004637
MIM 602716
UniProt ID O60500

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHS1 Products

Required fields are marked with *

My Review for All NPHS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon