Recombinant Human NPIP Protein, GST-tagged
| Cat.No. : | NPIP-6033H |
| Product Overview : | Human NPIP partial ORF ( NP_008916, 97 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NPIPB11 (Nuclear Pore Complex Interacting Protein Family Member B11) is a Protein Coding gene. An important paralog of this gene is NPIPB4. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | EGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NPIP nuclear pore complex interacting protein [ Homo sapiens ] |
| Official Symbol | NPIP |
| Synonyms | NPIP; nuclear pore complex interacting protein; nuclear pore complex-interacting protein; morpheus; FLJ42525; FLJ44848; |
| Gene ID | 9284 |
| mRNA Refseq | NM_006985 |
| Protein Refseq | NP_008916 |
| MIM | 606406 |
| UniProt ID | Q9UND3 |
| ◆ Recombinant Proteins | ||
| NPIP-6033H | Recombinant Human NPIP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPIP Products
Required fields are marked with *
My Review for All NPIP Products
Required fields are marked with *



