Recombinant Human NPIP Protein, GST-tagged

• Cat.No.: NPIP-6033H
• Product Overview: Human NPIP partial ORF ( NP_008916, 97 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NPIPB11 (Nuclear Pore Complex Interacting Protein Family Member B11) is a Protein Coding gene. An important paralog of this gene is NPIPB4.
• Molecular Mass: 36.74 kDa
• AA Sequence: EGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPIP nuclear pore complex interacting protein [ Homo sapiens ]
• Official Symbol: NPIP
• Synonyms: NPIP; nuclear pore complex interacting protein; nuclear pore complex-interacting protein; morpheus; FLJ42525; FLJ44848
• Gene ID: 9284
• mRNA Refseq: NM_006985
• Protein Refseq: NP_008916
• MIM: 606406
• UniProt ID: Q9UND3