Recombinant Human NPLOC4 Protein, His-tagged
| Cat.No. : | NPLOC4-1345H |
| Product Overview : | Recombinant Human NPLOC4 Protein(261-608 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | October 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 261-608 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | DIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCSTVGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQPGTGHCEMCSLPRT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | NPLOC4 nuclear protein localization 4 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NPLOC4 |
| Synonyms | NPLOC4; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; FLJ20657; KIAA1499; NPL4; FLJ23742; |
| Gene ID | 55666 |
| mRNA Refseq | NM_017921 |
| Protein Refseq | NP_060391 |
| MIM | 606590 |
| UniProt ID | Q8TAT6 |
| ◆ Recombinant Proteins | ||
| NPLOC4-10191Z | Recombinant Zebrafish NPLOC4 | +Inquiry |
| NPLOC4-6164M | Recombinant Mouse NPLOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPLOC4-4045R | Recombinant Rat NPLOC4 Protein | +Inquiry |
| NPLOC4-10825M | Recombinant Mouse NPLOC4 Protein | +Inquiry |
| Nploc4-4473M | Recombinant Mouse Nploc4 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPLOC4-3740HCL | Recombinant Human NPLOC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPLOC4 Products
Required fields are marked with *
My Review for All NPLOC4 Products
Required fields are marked with *
