Recombinant Human NPM1 Protein, GST-tagged
Cat.No. : | NPM1-6037H |
Product Overview : | Human NPM1 full-length ORF ( AAH02398.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM |
Molecular Mass : | 58.08 kDa |
AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
Official Symbol | NPM1 |
Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254; |
Gene ID | 4869 |
mRNA Refseq | NM_001037738 |
Protein Refseq | NP_001032827 |
MIM | 164040 |
UniProt ID | P06748 |
◆ Recombinant Proteins | ||
NPM1-346HF | Recombinant Full Length Human NPM1 Protein | +Inquiry |
Npm1-7990M | Recombinant Mouse Npm1 protein, His-tagged | +Inquiry |
NPM1-1607H | Recombinant Human NPM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Npm1-1297M | Recombinant Mouse Npm1 Protein, His-SUMO-tagged | +Inquiry |
NPM1-4728H | Recombinant Human NPM1 Protein (Gly20-Lys154), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *
0
Inquiry Basket