Recombinant Human NPM1 protein, His-tagged
Cat.No. : | NPM1-6322H |
Product Overview : | Recombinant Human NPM1 protein(P06748)(1-294aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-294aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
Official Symbol | NPM1 |
Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254; |
Gene ID | 4869 |
mRNA Refseq | NM_001037738 |
Protein Refseq | NP_001032827 |
MIM | 164040 |
UniProt ID | P06748 |
◆ Recombinant Proteins | ||
NPM1-4839H | Recombinant Human NPM1 protein, Flag-tagged | +Inquiry |
NPM1-3805H | Recombinant Human NPM1 protein(Met9-Leu158), His-tagged | +Inquiry |
NPM1-7985HFL | Recombinant Full Length Human NPM1 protein, Flag-tagged | +Inquiry |
NPM1-1607H | Recombinant Human NPM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPM1-4046R | Recombinant Rat NPM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *