Recombinant Human NPPB therapeutic protein(Nesiritide)

Cat.No. : NPPB-P029H
Product Overview : Recombinant Human Natriuretic Peptide B therapeutic protein is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). It is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 32aa
Description : This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. The expression product is the active ingredient of Natrecor and nesiritide.
Molecular Mass : 3464 Da
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : NPPB; BNP; BNP-32; Brain natriuretic peptide 32; Nesiritide; Nesiritide recombinant
Gene Name NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol NPPB
Synonyms NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID 4879
mRNA Refseq NM_002521
Protein Refseq NP_002512
MIM 600295
UniProt ID P16860
Chromosome Location 1p36.2
Pathway MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPB Products

Required fields are marked with *

My Review for All NPPB Products

Required fields are marked with *

0
cart-icon
0
compare icon