Recombinant Human NPR2 protein, GST-tagged
Cat.No. : | NPR2-323H |
Product Overview : | Recombinant Human NPR2(1 a.a. - 1023 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-1023 a.a. |
Description : | This gene encodes natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Both NPR1 and NPR2 contain five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracellularly a protein kinase homology domain, a helical hinge region involved in oligomerization, and a carboxyl-terminal guanylyl cyclase catalytic domain. The protein is the primary receptor for C-type natriuretic peptide (CNP), which upon ligand binding exhibits greatly increased guanylyl cyclase activity. Mutations in this gene are the cause of acromesomelic dysplasia Maroteaux type. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 140.5 kDa |
AA Sequence : | MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGAC SEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLG EFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVY ICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHG VTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDK TPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYG SLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP RGSLQGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPT TGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPA ERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRG ETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQ RHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKI HVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NPR2 natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B) [ Homo sapiens ] |
Official Symbol | NPR2 |
Synonyms | NPR2; natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B); acromesomelic dysplasia, Maroteaux type , AMDM, ANPRB, NPRB; atrial natriuretic peptide receptor 2; ANPb; GUCY2B; GC-B; ANP-B; NPR-B; ANPR-B; guanylate cyclase B; atrial natriuretic peptide B-type receptor; atrial natriuretic peptide receptor type B; AMDM; NPRB; ANPRB; GUC2B; NPRBi; |
Gene ID | 4882 |
mRNA Refseq | NM_003995 |
Protein Refseq | NP_003986 |
MIM | 108961 |
UniProt ID | P20594 |
Chromosome Location | 9p21-p12 |
Pathway | Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem; |
Function | ATP binding; GTP binding; guanylate cyclase activity; hormone binding; identical protein binding; natriuretic peptide receptor activity; nucleotide binding; peptide hormone binding; protein kinase activity; receptor activity; transferase activity, transferring phosphorus-containing groups; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
NPR2-3709R | Recombinant Rat NPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPR2-3081R | Recombinant Rhesus monkey NPR2 Protein, His-tagged | +Inquiry |
NPR2-30369TH | Recombinant Human NPR2 | +Inquiry |
NPR2-323H | Recombinant Human NPR2 protein, GST-tagged | +Inquiry |
NPR2-691H | Recombinant Human NPR2 Protein (23-458 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPR2 Products
Required fields are marked with *
My Review for All NPR2 Products
Required fields are marked with *
0
Inquiry Basket