Recombinant Human NPR2 protein, GST-tagged

Cat.No. : NPR2-323H
Product Overview : Recombinant Human NPR2(1 a.a. - 1023 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-1023 a.a.
Description : This gene encodes natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Both NPR1 and NPR2 contain five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracellularly a protein kinase homology domain, a helical hinge region involved in oligomerization, and a carboxyl-terminal guanylyl cyclase catalytic domain. The protein is the primary receptor for C-type natriuretic peptide (CNP), which upon ligand binding exhibits greatly increased guanylyl cyclase activity. Mutations in this gene are the cause of acromesomelic dysplasia Maroteaux type.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 140.5 kDa
AA Sequence : MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGAC SEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLG EFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVY ICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHG VTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDK TPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYG SLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP RGSLQGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPT TGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPA ERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRG ETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQ RHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKI HVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NPR2 natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B) [ Homo sapiens ]
Official Symbol NPR2
Synonyms NPR2; natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B); acromesomelic dysplasia, Maroteaux type , AMDM, ANPRB, NPRB; atrial natriuretic peptide receptor 2; ANPb; GUCY2B; GC-B; ANP-B; NPR-B; ANPR-B; guanylate cyclase B; atrial natriuretic peptide B-type receptor; atrial natriuretic peptide receptor type B; AMDM; NPRB; ANPRB; GUC2B; NPRBi;
Gene ID 4882
mRNA Refseq NM_003995
Protein Refseq NP_003986
MIM 108961
UniProt ID P20594
Chromosome Location 9p21-p12
Pathway Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function ATP binding; GTP binding; guanylate cyclase activity; hormone binding; identical protein binding; natriuretic peptide receptor activity; nucleotide binding; peptide hormone binding; protein kinase activity; receptor activity; transferase activity, transferring phosphorus-containing groups; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPR2 Products

Required fields are marked with *

My Review for All NPR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon