Recombinant Human NPRL2, His-tagged
Cat.No. : | NPRL2-29156TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-330 of Human NPR2L with N terminal His tag; MWt 38kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-330 a.a. |
Description : | NPR2L is homologous to yeast nitrogen permease and is a candidate tumor suppressor, being a negative regulator of cell cycle. Most abundant in skeletal muscle, followed by brain, liver, and pancreas, with lower amounts in lung, kidney, placenta, and heart. Expressed in most lung cancer cell lines tested. There are two isoforms, produced by alternative splicing. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTV QVYIITKPELQNKLITVTAMEKKLIGCPVCIEHKKYSR NALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELES SFVSMEESKQKLVPIMTILLEELNASGRCTLPIDESNT IHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGV VTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTK QGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHV DERKLIQFGLMKNLIRRLQKYP |
Gene Name | NPRL2 nitrogen permease regulator-like 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NPRL2 |
Synonyms | NPRL2; nitrogen permease regulator-like 2 (S. cerevisiae); tumor suppressor candidate 4 , TUSC4; nitrogen permease regulator 2-like protein; NPR2; NPR2L; |
Gene ID | 10641 |
mRNA Refseq | NM_006545 |
Protein Refseq | NP_006536 |
MIM | 607072 |
Uniprot ID | Q8WTW4 |
Chromosome Location | 3p21.3 |
Function | protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
NPRL2-10836M | Recombinant Mouse NPRL2 Protein | +Inquiry |
NPRL2-5484C | Recombinant Chicken NPRL2 | +Inquiry |
NPRL2-6173M | Recombinant Mouse NPRL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPRL2-29156TH | Recombinant Human NPRL2, His-tagged | +Inquiry |
NPRL2-4426Z | Recombinant Zebrafish NPRL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPRL2-3731HCL | Recombinant Human NPRL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPRL2 Products
Required fields are marked with *
My Review for All NPRL2 Products
Required fields are marked with *