Recombinant Human NPTX1 protein, His-GST&Myc-tagged
| Cat.No. : | NPTX1-3533H |
| Product Overview : | Recombinant Human NPTX1 protein(Q15818)(88-227aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 88-227aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDK |
| Gene Name | NPTX1 neuronal pentraxin I [ Homo sapiens ] |
| Official Symbol | NPTX1 |
| Synonyms | NPTX1; neuronal pentraxin I; neuronal pentraxin-1; NP-I; NP1; MGC105123; DKFZp686J2446; |
| Gene ID | 4884 |
| mRNA Refseq | NM_002522 |
| Protein Refseq | NP_002513 |
| MIM | 602367 |
| UniProt ID | Q15818 |
| ◆ Recombinant Proteins | ||
| NPTX1-3084R | Recombinant Rhesus monkey NPTX1 Protein, His-tagged | +Inquiry |
| NPTX1-397H | Recombinant Human NPTX1 Protein, His-tagged | +Inquiry |
| Nptx1-6733M | Recombinant Mouse Nptx1 protein, hFc-tagged | +Inquiry |
| Nptx1-4532M | Recombinant Mouse Nptx1 protein, His-tagged | +Inquiry |
| NPTX1-6651HF | Recombinant Full Length Human NPTX1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPTX1 Products
Required fields are marked with *
My Review for All NPTX1 Products
Required fields are marked with *
