Recombinant Human NPY
Cat.No. : | NPY-29247TH |
Product Overview : | Recombinant fragment corresponding to amino acids 29-97 of Human Neuropeptide Y with an N terminal proprietary tag; Predicted MWt 33.22 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 69 amino acids |
Description : | This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. |
Molecular Weight : | 33.220kDa inclusive of tags |
Tissue specificity : | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
Sequence Similarities : | Belongs to the NPY family. |
Gene Name | NPY neuropeptide Y [ Homo sapiens ] |
Official Symbol | NPY |
Synonyms | NPY; neuropeptide Y; pro-neuropeptide Y; PYY4; |
Gene ID | 4852 |
mRNA Refseq | NM_000905 |
Protein Refseq | NP_000896 |
MIM | 162640 |
Uniprot ID | P01303 |
Chromosome Location | 7p15.3 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | G-protein coupled receptor activity; G-protein coupled receptor binding; calcium channel regulator activity; neuropeptide Y receptor binding; neuropeptide hormone activity; |
◆ Recombinant Proteins | ||
NPY-3086R | Recombinant Rhesus monkey NPY Protein, His-tagged | +Inquiry |
NPY-4717H | Recombinant Human NPY protein, His-tagged | +Inquiry |
NPY-6654HF | Recombinant Full Length Human NPY Protein, GST-tagged | +Inquiry |
NPY-4718H | Recombinant Human NPY Protein (Tyr29-Trp97), N-His tagged | +Inquiry |
NPY-1267H | Recombinant Human NPY Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPY-3726HCL | Recombinant Human NPY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY Products
Required fields are marked with *
My Review for All NPY Products
Required fields are marked with *