Recombinant Human NPY

Cat.No. : NPY-29247TH
Product Overview : Recombinant fragment corresponding to amino acids 29-97 of Human Neuropeptide Y with an N terminal proprietary tag; Predicted MWt 33.22 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 69 amino acids
Description : This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases.
Molecular Weight : 33.220kDa inclusive of tags
Tissue specificity : One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Sequence Similarities : Belongs to the NPY family.
Gene Name NPY neuropeptide Y [ Homo sapiens ]
Official Symbol NPY
Synonyms NPY; neuropeptide Y; pro-neuropeptide Y; PYY4;
Gene ID 4852
mRNA Refseq NM_000905
Protein Refseq NP_000896
MIM 162640
Uniprot ID P01303
Chromosome Location 7p15.3
Pathway Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function G-protein coupled receptor activity; G-protein coupled receptor binding; calcium channel regulator activity; neuropeptide Y receptor binding; neuropeptide hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPY Products

Required fields are marked with *

My Review for All NPY Products

Required fields are marked with *

0
cart-icon
0
compare icon