Recombinant Human NR1D2 Protein, GST-tagged
| Cat.No. : | NR1D2-6068H |
| Product Overview : | Human NR1D2 full-length ORF ( AAH45613, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq |
| Molecular Mass : | 89.21 kDa |
| AA Sequence : | MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NR1D2 nuclear receptor subfamily 1, group D, member 2 [ Homo sapiens ] |
| Official Symbol | NR1D2 |
| Synonyms | NR1D2; nuclear receptor subfamily 1, group D, member 2; nuclear receptor subfamily 1 group D member 2; BD73; EAR 1r; Hs.37288; HZF2; RVR; rev-erb-beta; rev-erba-alpha-related receptor; V-erbA-related protein 1-related; orphan nuclear hormone receptor BD73; nuclear receptor Rev-ErbA beta variant 1; nuclear receptor Rev-ErbA beta variant 2; EAR-1R; |
| Gene ID | 9975 |
| mRNA Refseq | NM_001145425 |
| Protein Refseq | NP_001138897 |
| MIM | 602304 |
| UniProt ID | Q14995 |
| ◆ Recombinant Proteins | ||
| NR1D2-6693HF | Recombinant Full Length Human NR1D2 Protein, GST-tagged | +Inquiry |
| NRID2-1150H | Active Recombinant Human Nuclear R eceptor Subfamily 1, Group D, Member 2 | +Inquiry |
| Nr1d2-4484M | Recombinant Mouse Nr1d2 Protein, Myc/DDK-tagged | +Inquiry |
| NR1D2-8488H | Recombinant Human NR1D2, His-tagged | +Inquiry |
| Nr1d2-1082R | Recombinant Rat Nr1d2 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR1D2-3721HCL | Recombinant Human NR1D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR1D2 Products
Required fields are marked with *
My Review for All NR1D2 Products
Required fields are marked with *




