Recombinant Human NR1D2 Protein, GST-tagged
Cat.No. : | NR1D2-6068H |
Product Overview : | Human NR1D2 full-length ORF ( AAH45613, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq |
Molecular Mass : | 89.21 kDa |
AA Sequence : | MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR1D2 nuclear receptor subfamily 1, group D, member 2 [ Homo sapiens ] |
Official Symbol | NR1D2 |
Synonyms | NR1D2; nuclear receptor subfamily 1, group D, member 2; nuclear receptor subfamily 1 group D member 2; BD73; EAR 1r; Hs.37288; HZF2; RVR; rev-erb-beta; rev-erba-alpha-related receptor; V-erbA-related protein 1-related; orphan nuclear hormone receptor BD73; nuclear receptor Rev-ErbA beta variant 1; nuclear receptor Rev-ErbA beta variant 2; EAR-1R; |
Gene ID | 9975 |
mRNA Refseq | NM_001145425 |
Protein Refseq | NP_001138897 |
MIM | 602304 |
UniProt ID | Q14995 |
◆ Recombinant Proteins | ||
NR1D2-6068H | Recombinant Human NR1D2 Protein, GST-tagged | +Inquiry |
NR1D2-30452TH | Recombinant Human NR1D2 | +Inquiry |
NR1D2-8488H | Recombinant Human NR1D2, His-tagged | +Inquiry |
Nr1d2-1082R | Recombinant Rat Nr1d2 protein, His & GST-tagged | +Inquiry |
NRID2-1150H | Active Recombinant Human Nuclear R eceptor Subfamily 1, Group D, Member 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR1D2-3721HCL | Recombinant Human NR1D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR1D2 Products
Required fields are marked with *
My Review for All NR1D2 Products
Required fields are marked with *