Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NR2C2AP-5708H |
| Product Overview : | NR2C2AP MS Standard C13 and N15-labeled recombinant protein (NP_795361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | NR2C2AP (Nuclear Receptor 2C2 Associated Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. |
| Molecular Mass : | 15.9 kDa |
| AA Sequence : | MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NR2C2AP nuclear receptor 2C2-associated protein [ Homo sapiens (human) ] |
| Official Symbol | NR2C2AP |
| Synonyms | NR2C2AP; nuclear receptor 2C2-associated protein; TR4 orphan receptor associated protein TRA16; TRA16; repressor for TR4 transactivation; TR4 orphan receptor-associated 16 kDa protein; |
| Gene ID | 126382 |
| mRNA Refseq | NM_176880 |
| Protein Refseq | NP_795361 |
| MIM | 608719 |
| UniProt ID | Q86WQ0 |
| ◆ Recombinant Proteins | ||
| NR2C2AP-6185M | Recombinant Mouse NR2C2AP Protein, His (Fc)-Avi-tagged | +Inquiry |
| NR2C2AP-4312Z | Recombinant Zebrafish NR2C2AP | +Inquiry |
| Nr2c2ap-4489M | Recombinant Mouse Nr2c2ap Protein, Myc/DDK-tagged | +Inquiry |
| NR2C2AP-10863M | Recombinant Mouse NR2C2AP Protein | +Inquiry |
| NR2C2AP-5708H | Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR2C2AP-3712HCL | Recombinant Human NR2C2AP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR2C2AP Products
Required fields are marked with *
My Review for All NR2C2AP Products
Required fields are marked with *
