Recombinant Human NR2E1 protein, T7/His-tagged

Cat.No. : NR2E1-130H
Product Overview : Recombinant human NR2E1 cDNA (384aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRN RTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPS AALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSI KWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVV ARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLL PALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name NR2E1 nuclear receptor subfamily 2, group E, member 1 [ Homo sapiens ]
Official Symbol NR2E1
Synonyms NR2E1; nuclear receptor subfamily 2, group E, member 1; TLX; nuclear receptor subfamily 2 group E member 1; TLL; XTLL; hTll; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog;
Gene ID 7101
mRNA Refseq NM_003269
Protein Refseq NP_003260
MIM 603849
UniProt ID Q9Y466
Chromosome Location 6q21
Pathway Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem;
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2E1 Products

Required fields are marked with *

My Review for All NR2E1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon