Recombinant Human NR2E1 protein, T7/His-tagged

• Cat.No.: NR2E1-130H
• Product Overview: Recombinant human NR2E1 cDNA (384aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRN RTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPS AALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSI KWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVV ARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLL PALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: NR2E1 nuclear receptor subfamily 2, group E, member 1 [ Homo sapiens ]
• Official Symbol: NR2E1
• Synonyms: NR2E1; nuclear receptor subfamily 2, group E, member 1; TLX; nuclear receptor subfamily 2 group E member 1; TLL; XTLL; hTll; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog
• Gene ID: 7101
• mRNA Refseq: NM_003269
• Protein Refseq: NP_003260
• MIM: 603849
• UniProt ID: Q9Y466
• Chromosome Location: 6q21
• Pathway: Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto