Recombinant Human NR2E1 protein, T7/His-tagged
Cat.No. : | NR2E1-130H |
Product Overview : | Recombinant human NR2E1 cDNA (384aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRN RTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPS AALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSI KWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVV ARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLL PALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NR2E1 nuclear receptor subfamily 2, group E, member 1 [ Homo sapiens ] |
Official Symbol | NR2E1 |
Synonyms | NR2E1; nuclear receptor subfamily 2, group E, member 1; TLX; nuclear receptor subfamily 2 group E member 1; TLL; XTLL; hTll; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog; |
Gene ID | 7101 |
mRNA Refseq | NM_003269 |
Protein Refseq | NP_003260 |
MIM | 603849 |
UniProt ID | Q9Y466 |
Chromosome Location | 6q21 |
Pathway | Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem; |
Function | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto |
◆ Recombinant Proteins | ||
NR2E1-6738HF | Recombinant Full Length Human NR2E1 Protein, GST-tagged | +Inquiry |
NR2E1-3095R | Recombinant Rhesus monkey NR2E1 Protein, His-tagged | +Inquiry |
NR2E1-6725C | Recombinant Chicken NR2E1 | +Inquiry |
NR2E1-6186M | Recombinant Mouse NR2E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2E1-10864M | Recombinant Mouse NR2E1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2E1-1216HCL | Recombinant Human NR2E1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2E1 Products
Required fields are marked with *
My Review for All NR2E1 Products
Required fields are marked with *
0
Inquiry Basket