Recombinant Human NR3C2 Protein, GST tagged
Cat.No. : | NR3C2-01H |
Product Overview : | Recombinant Human NR3C2 Protein (604-984 aa) with GST tag was expressed in Baculovirus-Insect cells. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | GST |
Protein Length : | 604-984 aa |
Description : | This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. |
Source : | Insect cells |
Species : | Human |
Tag : | GST |
Molecular Weight : | 71 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.2, 10mM Glutathione |
Concentration : | 0.21 mg/mL by Bradford |
Gene Name | NR3C2 nuclear receptor subfamily 3, group C, member 2 [ Homo sapiens (human) ] |
Official Symbol | NR3C2 |
Synonyms | NR3C2; nuclear receptor subfamily 3, group C, member 2; MLR; mineralocorticoid receptor; MR; aldosterone receptor; mineralocorticoid receptor 1; mineralocorticoid receptor delta; MCR; NR3C2VIT; FLJ41052; MGC133092 |
Gene ID | 4306 |
mRNA Refseq | NM_000901 |
Protein Refseq | NP_000892 |
MIM | 600983 |
UniProt ID | P08235 |
◆ Recombinant Proteins | ||
NR3C2-3940C | Recombinant Chicken NR3C2 | +Inquiry |
NR3C2-01H | Recombinant Human NR3C2 Protein, GST tagged | +Inquiry |
NR3C2-5892Z | Recombinant Zebrafish NR3C2 | +Inquiry |
NR3C2-4069R | Recombinant Rat NR3C2 Protein | +Inquiry |
NR3C2-3169H | Recombinant Human NR3C2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR3C2 Products
Required fields are marked with *
My Review for All NR3C2 Products
Required fields are marked with *
0
Inquiry Basket