Recombinant Human NR3C2 Protein, GST tagged

Cat.No. : NR3C2-01H
Product Overview : Recombinant Human NR3C2 Protein (604-984 aa) with GST tag was expressed in Baculovirus-Insect cells.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : GST
Protein Length : 604-984 aa
Description : This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
Source : Insect cells
Species : Human
Tag : GST
Molecular Weight : 71 kDa
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.2, 10mM Glutathione
Concentration : 0.21 mg/mL by Bradford
Gene Name NR3C2 nuclear receptor subfamily 3, group C, member 2 [ Homo sapiens (human) ]
Official Symbol NR3C2
Synonyms NR3C2; nuclear receptor subfamily 3, group C, member 2; MLR; mineralocorticoid receptor; MR; aldosterone receptor; mineralocorticoid receptor 1; mineralocorticoid receptor delta; MCR; NR3C2VIT; FLJ41052; MGC133092
Gene ID 4306
mRNA Refseq NM_000901
Protein Refseq NP_000892
MIM 600983
UniProt ID P08235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR3C2 Products

Required fields are marked with *

My Review for All NR3C2 Products

Required fields are marked with *

0
cart-icon
0
compare icon