Recombinant Human NRAP Protein, GST-tagged
Cat.No. : | NRAP-6104H |
Product Overview : | Human NRAP partial ORF ( NP_932326.2, 1640 a.a. - 1727 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NRAP (Nebulin Related Anchoring Protein) is a Protein Coding gene. GO annotations related to this gene include actin binding and muscle alpha-actinin binding. An important paralog of this gene is NEB. |
Molecular Mass : | 35.42 kDa |
AA Sequence : | LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NRAP nebulin related anchoring protein [ Homo sapiens (human) ] |
Official Symbol | NRAP |
Synonyms | NRAP; nebulin related anchoring protein; N-RAP; nebulin-related-anchoring protein; |
Gene ID | 4892 |
mRNA Refseq | NM_001261463 |
Protein Refseq | NP_001248392 |
MIM | 602873 |
UniProt ID | Q86VF7 |
◆ Recombinant Proteins | ||
NRAP-1856H | Recombinant Human NRAP Protein, His&GST-tagged | +Inquiry |
Nrap-1857M | Recombinant Mouse Nrap Protein, His-tagged | +Inquiry |
Nrap-1858R | Recombinant Rat Nrap Protein, His-tagged | +Inquiry |
NRAP-6194M | Recombinant Mouse NRAP Protein, His (Fc)-Avi-tagged | +Inquiry |
NRAP-4298Z | Recombinant Zebrafish NRAP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRAP Products
Required fields are marked with *
My Review for All NRAP Products
Required fields are marked with *