Recombinant Human NRAS Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NRAS-3519H |
| Product Overview : | NRAS MS Standard C13 and N15-labeled recombinant protein (NP_002515) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. |
| Molecular Mass : | 21.2 kDa |
| AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NRAS NRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
| Official Symbol | NRAS |
| Synonyms | NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1; |
| Gene ID | 4893 |
| mRNA Refseq | NM_002524 |
| Protein Refseq | NP_002515 |
| MIM | 164790 |
| UniProt ID | P01111 |
| ◆ Recombinant Proteins | ||
| NRAS-0936H | Recombinant Human NRAS Protein (T2-K169, Q61H), Tag Free | +Inquiry |
| NRAS-30411TH | Recombinant Human NRAS Protein | +Inquiry |
| NRAS-0934H | Recombinant Human NRAS Protein (T2-K169, Q61L), Tag Free | +Inquiry |
| NRAS-0937H | Recombinant Human NRAS Protein (T2-K169, Q61R), GST tagged | +Inquiry |
| NRAS-172HFL | Recombinant Full Length Human NRAS Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *
