Recombinant Human NRBP1 Protein, GST-tagged

Cat.No. : NRBP1-6109H
Product Overview : Human NRBP partial ORF ( AAH01221, 436 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NRBP1 (Nuclear Receptor Binding Protein 1) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. GO annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is NRBP2.
Molecular Mass : 36.63 kDa
AA Sequence : PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRBP1 nuclear receptor binding protein 1 [ Homo sapiens ]
Official Symbol NRBP1
Synonyms NRBP1; nuclear receptor binding protein 1; NRBP, nuclear receptor binding protein; nuclear receptor-binding protein; BCON3; MADM; MUDPNP; multiple domain putative nuclear protein; myeloid leukemia factor 1 adaptor molecule; NRBP; FLJ27109; FLJ35541;
Gene ID 29959
mRNA Refseq NM_013392
Protein Refseq NP_037524
MIM 606010
UniProt ID Q9UHY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRBP1 Products

Required fields are marked with *

My Review for All NRBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon