Recombinant Human NRBP2, His-tagged
Cat.No. : | NRBP2-30413TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-258 of Human NRBP2 with an N terminal His tag. Predicted mwt: 31 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-258 a.a. |
Description : | NRBP2 belongs to the protein kinase superfamily, and the Ser/Thr protein kinase family. It contains 1 protein kinase domain. There are two different isoforms produced by alternative splicing. The exact function of the protein is still unknown. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 130 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | MCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFI LCCLARDPARRPSAHSLLFHRVLFEVHSLKLLAAHCFI QHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYS EVSFMELDKFLEDVRNGIYPLMNFAATRPLGLPRVLAP PPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKAR WHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELVHYGFL HEDDRMKLAAFLESTFLKYRGTQA |
Full Length : | Full L. |
Gene Name | NRBP2 nuclear receptor binding protein 2 [ Homo sapiens ] |
Official Symbol | NRBP2 |
Synonyms | NRBP2; nuclear receptor binding protein 2; nuclear receptor-binding protein 2; DKFZp434P086; |
Gene ID | 340371 |
mRNA Refseq | NM_178564 |
Protein Refseq | NP_848659 |
Uniprot ID | Q9NSY0 |
Chromosome Location | 8q24.3 |
Function | ATP binding; NOT nucleotide binding; NOT protein kinase activity; transferase activity, transferring phosphorus-containing groups; |
◆ Recombinant Proteins | ||
NRBP2-10883M | Recombinant Mouse NRBP2 Protein | +Inquiry |
NRBP2-1364H | Recombinant Human NRBP2, GST-tagged | +Inquiry |
NRBP2-6111H | Recombinant Human NRBP2 Protein, GST-tagged | +Inquiry |
NRBP2-30413TH | Recombinant Human NRBP2, His-tagged | +Inquiry |
NRBP2-6754HF | Recombinant Full Length Human NRBP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRBP2-3700HCL | Recombinant Human NRBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRBP2 Products
Required fields are marked with *
My Review for All NRBP2 Products
Required fields are marked with *
0
Inquiry Basket