Recombinant Human NRG1 Protein, GMP Grade, Animal-Free

Cat.No. : NRG1-31HG
Product Overview : GMP Recombinant Human NRG1 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Neuregulin/Heregulin is a family of structurally-related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms releases soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain; the latter is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity that leads to tyrosine phosphorylation. Although HRG1-β1's biological effects are still unclear, it has been found to promote motility and invasiveness of breast cancer cells, which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF).
AA Sequence : SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name NRG1 neuregulin 1 [ Homo sapiens (human) ]
Official Symbol NRG1
Synonyms NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131;
Gene ID 3084
mRNA Refseq NM_001159995
Protein Refseq NP_001153467
MIM 142445
UniProt ID Q02297

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRG1 Products

Required fields are marked with *

My Review for All NRG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon