Recombinant Human NRG2 Protein (112-405 aa), His-tagged
Cat.No. : | NRG2-1741H |
Product Overview : | Recombinant Human NRG2 Protein (112-405 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 112-405 aa |
Description : | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.8 kDa |
AA Sequence : | CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | NRG2 neuregulin 2 [ Homo sapiens ] |
Official Symbol | NRG2 |
Synonyms | NRG2; neuregulin 2; Don 1; HRG2; NTAK; pro-NRG2; divergent of neuregulin-1; DON1; |
Gene ID | 9542 |
mRNA Refseq | NM_001184935 |
Protein Refseq | NP_001171864 |
MIM | 603818 |
UniProt ID | O14511 |
◆ Recombinant Proteins | ||
NRG2-363H | Recombinant Human NRG2 Protein, His-tagged | +Inquiry |
NRG2-4080R | Recombinant Rat NRG2 Protein | +Inquiry |
RFL9940MF | Recombinant Full Length Mouse Pro-Neuregulin-2, Membrane-Bound Isoform(Nrg2) Protein, His-Tagged | +Inquiry |
NRG2-693H | Recombinant Human NRG2 Protein (112-405 aa), His-SUMO-tagged | +Inquiry |
NRG2-683H | Recombinant Human NRG2 Protein (Cys112-Lys404), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG2 Products
Required fields are marked with *
My Review for All NRG2 Products
Required fields are marked with *
0
Inquiry Basket