Recombinant Human NRK protein, GST-tagged
Cat.No. : | NRK-15H |
Product Overview : | Recombinant Human NRK(1483 a.a. - 1582 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1483-1582 a.a. |
Description : | The mouse ortholog of this gene encodes a protein kinase required for JNK activation. The encoded protein may be involved in the induction of actin polymerization in late embryogenesis. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NRK Nik related kinase [ Homo sapiens ] |
Official Symbol | NRK |
Synonyms | NRK; Nik related kinase; nik-related protein kinase; DKFZp686A17109; NESK; FLJ16788; MGC131849; |
Gene ID | 203447 |
mRNA Refseq | NM_198465 |
Protein Refseq | NP_940867 |
MIM | 300791 |
UniProt ID | Q7Z2Y5 |
Chromosome Location | Xq22.3 |
Pathway | TNF receptor signaling pathway, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; protein serine/threonine kinase activity; small GTPase regulator activity; |
◆ Recombinant Proteins | ||
NRK-15H | Recombinant Human NRK protein, GST-tagged | +Inquiry |
NRK-6205M | Recombinant Mouse NRK Protein, His (Fc)-Avi-tagged | +Inquiry |
NRK-2798C | Recombinant Chicken NRK | +Inquiry |
NRK-437H | Recombinant Human NRK | +Inquiry |
NRK-10893M | Recombinant Mouse NRK Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRK Products
Required fields are marked with *
My Review for All NRK Products
Required fields are marked with *
0
Inquiry Basket