Recombinant Human NRL protein, His&Myc-tagged
| Cat.No. : | NRL-3293H |
| Product Overview : | Recombinant Human NRL protein(P54845)(1-237aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-237aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.4 kDa |
| AA Sequence : | MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | NRL neural retina leucine zipper [ Homo sapiens ] |
| Official Symbol | NRL |
| Synonyms | NRL; neural retina leucine zipper; neural retina-specific leucine zipper protein; D14S46E; NRL MAF; RP27; neural retinal-specific leucine zipper; NRL-MAF; |
| Gene ID | 4901 |
| mRNA Refseq | NM_006177 |
| Protein Refseq | NP_006168 |
| UniProt ID | P54845 |
| ◆ Recombinant Proteins | ||
| NRL-293H | Recombinant Human NRL | +Inquiry |
| NRL-3762Z | Recombinant Zebrafish NRL | +Inquiry |
| NRL-6206M | Recombinant Mouse NRL Protein, His (Fc)-Avi-tagged | +Inquiry |
| NRL-3293H | Recombinant Human NRL protein, His&Myc-tagged | +Inquiry |
| NRL-3683H | Recombinant Human NRL Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRL-3693HCL | Recombinant Human NRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRL Products
Required fields are marked with *
My Review for All NRL Products
Required fields are marked with *
