Recombinant Human NSF protein(394-744 aa), His-tagged

Cat.No. : NSF-1372H
Product Overview : Recombinant Human NSF protein(394-744 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability November 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 394-744 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name NSF N-ethylmaleimide-sensitive factor [ Homo sapiens ]
Official Symbol NSF
Synonyms NSF; N-ethylmaleimide-sensitive factor; vesicle-fusing ATPase; N ethylmaleimide sensitive factor like protein; SKD2; NEM-sensitive fusion protein; vesicular-fusion protein NSF; N-ethylmaleimide-sensitive fusion protein; N-ethylmaleimide-sensitive factor-like protein
Gene ID 4905
mRNA Refseq NM_006178
Protein Refseq NP_006169
MIM 601633
UniProt ID P46459

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NSF Products

Required fields are marked with *

My Review for All NSF Products

Required fields are marked with *

0
cart-icon
0
compare icon