Recombinant Human NSF protein(394-744 aa), His-tagged
| Cat.No. : | NSF-1372H |
| Product Overview : | Recombinant Human NSF protein(394-744 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 394-744 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | NSF N-ethylmaleimide-sensitive factor [ Homo sapiens ] |
| Official Symbol | NSF |
| Synonyms | NSF; N-ethylmaleimide-sensitive factor; vesicle-fusing ATPase; N ethylmaleimide sensitive factor like protein; SKD2; NEM-sensitive fusion protein; vesicular-fusion protein NSF; N-ethylmaleimide-sensitive fusion protein; N-ethylmaleimide-sensitive factor-like protein |
| Gene ID | 4905 |
| mRNA Refseq | NM_006178 |
| Protein Refseq | NP_006169 |
| MIM | 601633 |
| UniProt ID | P46459 |
| ◆ Recombinant Proteins | ||
| NSF-7980H | Recombinant Human NSF protein, His & T7-tagged | +Inquiry |
| Nsf-4506M | Recombinant Mouse Nsf Protein, Myc/DDK-tagged | +Inquiry |
| NSF-6218M | Recombinant Mouse NSF Protein, His (Fc)-Avi-tagged | +Inquiry |
| NSF-2180C | Recombinant Chicken NSF | +Inquiry |
| NSF-1372H | Recombinant Human NSF protein(394-744 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NSF-3688HCL | Recombinant Human NSF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSF Products
Required fields are marked with *
My Review for All NSF Products
Required fields are marked with *



