Recombinant Human NSF protein(394-744 aa), His-tagged
Cat.No. : | NSF-1372H |
Product Overview : | Recombinant Human NSF protein(394-744 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 394-744 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | NSF N-ethylmaleimide-sensitive factor [ Homo sapiens ] |
Official Symbol | NSF |
Synonyms | NSF; N-ethylmaleimide-sensitive factor; vesicle-fusing ATPase; N ethylmaleimide sensitive factor like protein; SKD2; NEM-sensitive fusion protein; vesicular-fusion protein NSF; N-ethylmaleimide-sensitive fusion protein; N-ethylmaleimide-sensitive factor-like protein |
Gene ID | 4905 |
mRNA Refseq | NM_006178 |
Protein Refseq | NP_006169 |
MIM | 601633 |
UniProt ID | P46459 |
◆ Recombinant Proteins | ||
NSF-1282R | Recombinant Rat NSF Protein (7-209 aa), His-tagged | +Inquiry |
NSF-10909M | Recombinant Mouse NSF Protein | +Inquiry |
NSF-6218M | Recombinant Mouse NSF Protein, His (Fc)-Avi-tagged | +Inquiry |
NSF-1372H | Recombinant Human NSF protein(394-744 aa), His-tagged | +Inquiry |
NSF-4091R | Recombinant Rat NSF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSF-3688HCL | Recombinant Human NSF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSF Products
Required fields are marked with *
My Review for All NSF Products
Required fields are marked with *
0
Inquiry Basket