Recombinant Human NSUN5 protein, His-tagged
Cat.No. : | NSUN5-3815H |
Product Overview : | Recombinant Human NSUN5 protein(117-466 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117-466 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NSUN5 NOP2/Sun domain family, member 5 [ Homo sapiens ] |
Official Symbol | NSUN5 |
Synonyms | NOL1; p120; NOL1R; NSUN5A; WBSCR20; WBSCR20A |
Gene ID | 55695 |
mRNA Refseq | NM_148956.2 |
Protein Refseq | NP_683759.1 |
UniProt ID | Q96P11 |
◆ Recombinant Proteins | ||
NSUN5-12476Z | Recombinant Zebrafish NSUN5 | +Inquiry |
NSUN5-6225M | Recombinant Mouse NSUN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NSUN5-1378H | Recombinant Human NSUN5, GST-tagged | +Inquiry |
NSUN5-1379H | Recombinant Human NSUN5 protein, GST-tagged | +Inquiry |
NSUN5-594HF | Recombinant Full Length Human NSUN5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSUN5-3681HCL | Recombinant Human NSUN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSUN5 Products
Required fields are marked with *
My Review for All NSUN5 Products
Required fields are marked with *
0
Inquiry Basket