Recombinant Human NT5C protein, His-tagged
| Cat.No. : | NT5C-3533H |
| Product Overview : | Recombinant Human NT5C protein(Q8TCD5)(1-201aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-201aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE |
| Gene Name | NT5C 5, 3-nucleotidase, cytosolic [ Homo sapiens ] |
| Official Symbol | NT5C |
| Synonyms | NT5C; 5, 3-nucleotidase, cytosolic; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C , UMPH2, uridine 5 prime monophosphate hydrolase 2; 5(3)-deoxyribonucleotidase, cytosolic type; cdN; DNT 1; dNT 1; DNT1; PN I; deoxy-5-nucleotidase 1; cytosolic 5,3-pyrimidine nucleotidase; uridine 5-prime monophosphate hydrolase 2; uridine 5-monophosphate phosphohydrolase 2; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C; DNT; P5N2; PN-I; PN-II; UMPH2; dNT-1; |
| Gene ID | 30833 |
| mRNA Refseq | NM_001252377 |
| Protein Refseq | NP_001239306 |
| MIM | 191720 |
| UniProt ID | Q8TCD5 |
| ◆ Recombinant Proteins | ||
| Nt5c-1865M | Recombinant Mouse Nt5c Protein, His-tagged | +Inquiry |
| NT5C-4633H | Recombinant Human NT5C protein, His&Myc-tagged | +Inquiry |
| NT5C-2153HFL | Recombinant Full Length Human NT5C Protein, C-Flag-tagged | +Inquiry |
| NT5C-3533H | Recombinant Human NT5C protein, His-tagged | +Inquiry |
| NT5C-6577H | Recombinant Human NT5C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NT5C-1225HCL | Recombinant Human NT5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C Products
Required fields are marked with *
My Review for All NT5C Products
Required fields are marked with *
