Recombinant Human NT5C2 protein, His-tagged
| Cat.No. : | NT5C2-3473H |
| Product Overview : | Recombinant Human NT5C2 protein(209-561 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 209-561 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | HYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NT5C2 5-nucleotidase, cytosolic II [ Homo sapiens ] |
| Official Symbol | NT5C2 |
| Synonyms | NT5C2; 5-nucleotidase, cytosolic II; 5 nucleotidase (purine), cytosolic type B , NT5B; cytosolic purine 5-nucleotidase; cN II; GMP; PNT5; purine 5 nucleotidase; IMP-specific 5-NT; cytosolic 5-nucleotidase II; 5-nucleotidase (purine), cytosolic type B; NT5B; cN-II; |
| Gene ID | 22978 |
| mRNA Refseq | NM_001134373 |
| Protein Refseq | NP_001127845 |
| MIM | 600417 |
| UniProt ID | P49902 |
| ◆ Recombinant Proteins | ||
| NT5C2-2894C | Recombinant Chicken NT5C2 | +Inquiry |
| Nt5c2-4515M | Recombinant Mouse Nt5c2 Protein, Myc/DDK-tagged | +Inquiry |
| NT5C2-257H | Recombinant Human NT5C2 protein, MYC/DDK-tagged | +Inquiry |
| NT5C2-2930R | Recombinant Rhesus Macaque NT5C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NT5C2-258H | Recombinant Human NT5C2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C2 Products
Required fields are marked with *
My Review for All NT5C2 Products
Required fields are marked with *
