Recombinant Human NT5C2 protein, His-tagged

Cat.No. : NT5C2-3473H
Product Overview : Recombinant Human NT5C2 protein(209-561 aa), fused to His tag, was expressed in E. coli.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 209-561 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : HYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NT5C2 5-nucleotidase, cytosolic II [ Homo sapiens ]
Official Symbol NT5C2
Synonyms NT5C2; 5-nucleotidase, cytosolic II; 5 nucleotidase (purine), cytosolic type B , NT5B; cytosolic purine 5-nucleotidase; cN II; GMP; PNT5; purine 5 nucleotidase; IMP-specific 5-NT; cytosolic 5-nucleotidase II; 5-nucleotidase (purine), cytosolic type B; NT5B; cN-II;
Gene ID 22978
mRNA Refseq NM_001134373
Protein Refseq NP_001127845
MIM 600417
UniProt ID P49902

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NT5C2 Products

Required fields are marked with *

My Review for All NT5C2 Products

Required fields are marked with *

0
cart-icon