Recombinant Human NT5C2 protein, His-tagged
Cat.No. : | NT5C2-3473H |
Product Overview : | Recombinant Human NT5C2 protein(209-561 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 209-561 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NT5C2 5-nucleotidase, cytosolic II [ Homo sapiens ] |
Official Symbol | NT5C2 |
Synonyms | NT5C2; 5-nucleotidase, cytosolic II; 5 nucleotidase (purine), cytosolic type B , NT5B; cytosolic purine 5-nucleotidase; cN II; GMP; PNT5; purine 5 nucleotidase; IMP-specific 5-NT; cytosolic 5-nucleotidase II; 5-nucleotidase (purine), cytosolic type B; NT5B; cN-II; |
Gene ID | 22978 |
mRNA Refseq | NM_001134373 |
Protein Refseq | NP_001127845 |
MIM | 600417 |
UniProt ID | P49902 |
◆ Recombinant Proteins | ||
NT5C2-29445TH | Recombinant Human NT5C2, His-tagged | +Inquiry |
Nt5c2-4515M | Recombinant Mouse Nt5c2 Protein, Myc/DDK-tagged | +Inquiry |
NT5C2-2930R | Recombinant Rhesus Macaque NT5C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5C2-1381H | Recombinant Human NT5C2, GST-tagged | +Inquiry |
NT5C2-256H | Recombinant Human NT5C2 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C2-3677HCL | Recombinant Human NT5C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C2 Products
Required fields are marked with *
My Review for All NT5C2 Products
Required fields are marked with *