Recombinant Human NT5E
Cat.No. : | NT5E-27507TH |
Product Overview : | Recombinant fragment of Human CD73 with a proprietary tag; predicted MWt 52.18 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 238 amino acids |
Description : | The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 52.180kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR |
Sequence Similarities : | Belongs to the 5-nucleotidase family. |
Gene Name | NT5E 5-nucleotidase, ecto (CD73) [ Homo sapiens ] |
Official Symbol | NT5E |
Synonyms | NT5E; 5-nucleotidase, ecto (CD73); 5 nucleotidase (CD73) , NT5; 5-nucleotidase; CD73; eN; eNT; |
Gene ID | 4907 |
mRNA Refseq | NM_001204813 |
Protein Refseq | NP_001191742 |
MIM | 129190 |
Uniprot ID | P21589 |
Chromosome Location | 6q14-q21 |
Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; |
Function | 5-nucleotidase activity; ferrous iron binding; hydrolase activity, acting on ester bonds; metal ion binding; nucleotide binding; |
◆ Recombinant Proteins | ||
NT5E-1160H | Recombinant Human NT5E Protein, His-tagged | +Inquiry |
NT5E-5036H | Recombinant Human NT5E, His-tagged | +Inquiry |
NT5E-3859HB | Recombinant Human NT5E protein, His-tagged, Biotinylated | +Inquiry |
NT5E-11171Z | Recombinant Zebrafish NT5E | +Inquiry |
Nt5e-667M | Active Recombinant Mouse Nt5e Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5E-1082RCL | Recombinant Rat NT5E cell lysate | +Inquiry |
NT5E-2073HCL | Recombinant Human NT5E cell lysate | +Inquiry |
NT5E-1153CCL | Recombinant Cynomolgus NT5E cell lysate | +Inquiry |
NT5E-2491MCL | Recombinant Mouse NT5E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5E Products
Required fields are marked with *
My Review for All NT5E Products
Required fields are marked with *