Recombinant Human NT5E
| Cat.No. : | NT5E-27507TH |
| Product Overview : | Recombinant fragment of Human CD73 with a proprietary tag; predicted MWt 52.18 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 238 amino acids |
| Description : | The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 52.180kDa |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR |
| Sequence Similarities : | Belongs to the 5-nucleotidase family. |
| Gene Name | NT5E 5-nucleotidase, ecto (CD73) [ Homo sapiens ] |
| Official Symbol | NT5E |
| Synonyms | NT5E; 5-nucleotidase, ecto (CD73); 5 nucleotidase (CD73) , NT5; 5-nucleotidase; CD73; eN; eNT; |
| Gene ID | 4907 |
| mRNA Refseq | NM_001204813 |
| Protein Refseq | NP_001191742 |
| MIM | 129190 |
| Uniprot ID | P21589 |
| Chromosome Location | 6q14-q21 |
| Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; |
| Function | 5-nucleotidase activity; ferrous iron binding; hydrolase activity, acting on ester bonds; metal ion binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| NT5E-343H | Active Recombinant Human NT5E, His-tagged | +Inquiry |
| NT5E-435H | Recombinant Human 5'-nucleotidase, ecto (CD73), His-tagged | +Inquiry |
| NT5E-3859H | Recombinant Human NT5E protein, His-tagged | +Inquiry |
| Nt5e-2302M | Recombinant Mouse Nt5e protein, His-tagged | +Inquiry |
| NT5E-5633C | Recombinant Cynomolgus NT5E protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NT5E-2073HCL | Recombinant Human NT5E cell lysate | +Inquiry |
| NT5E-1153CCL | Recombinant Cynomolgus NT5E cell lysate | +Inquiry |
| NT5E-1082RCL | Recombinant Rat NT5E cell lysate | +Inquiry |
| NT5E-2491MCL | Recombinant Mouse NT5E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5E Products
Required fields are marked with *
My Review for All NT5E Products
Required fields are marked with *
