Recombinant Human NTF3 Protein, His tagged

• Cat.No.: NT3-22H
• Product Overview: Recombinant Human NTF3 Protein with His tag was expressed in insect cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 139-257 aa
• Description: The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse.
• AASequence: MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRTHHHHHHHH
• Molecular Mass: 15 kDa
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 0.05% SKL
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: NTF3 neurotrophin 3 [ Homo sapiens (human) ]
• Official Symbol: NTF3
• Synonyms: NTF3; neurotrophin 3; neurotrophin-3; NGF2; NT-3; neurotrophic factor; nerve growth factor 2; NT3; HDNF; NGF-2; MGC129711
• Gene ID: 4908
• mRNA Refseq: NM_001102654
• Protein Refseq: NP_001096124
• MIM: 162660
• UniProt ID: P20783