Recombinant Human NTNG1, His-tagged
Cat.No. : | NTNG1-155H |
Product Overview : | Recombinant Human Netrin-G1/NTNG1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His29-Ser409) of Human Netrin-G1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 29-409 a.a. |
Description : | Netrin-G1 (NTNG1) is a member of a conserved family of proteins that act as axon guidance cues during vertebrate nervous system development. Netrin-G1 contains one laminin EGF-like domain and one laminin N-terminal domain, Netrin-G1 is highly expressed in the thalamus, lowly in other tissue. Netrin-G1 localizes to the cell membrane. Netrin-G1 interacts with NGL1 and is glycosylated in the N-terminal. In addition, Netrin-G1 can promotesneurite outgrowth of both axons and dendrites. |
AA Sequence : | HYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMC61NNE CDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNI121VITFE SGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTE181EYSTGYT TNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLR241PAVGEIFVD ELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGK31CKKNYQGRPWS PGSYLPIPKGTANTCIPSISSIGTNVCDNELLHCQNGGTCHNNVRCLCP361AAYTGILCEKLRC EEAGSCGSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
NTNG1-155H | Recombinant Human NTNG1, His-tagged | +Inquiry |
NTNG1-4122H | Recombinant Human NTNG1 Protein (His29-Ser409), C-His tagged | +Inquiry |
NTNG1-10941M | Recombinant Mouse NTNG1 Protein | +Inquiry |
NTNG1-6236M | Recombinant Mouse NTNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTNG1-156H | Recombinant Human NTNG1(His29-Ser409) Protein, C-Avi-6*His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTNG1-3667HCL | Recombinant Human NTNG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTNG1 Products
Required fields are marked with *
My Review for All NTNG1 Products
Required fields are marked with *
0
Inquiry Basket