Recombinant Human NUCB1, His-tagged
Cat.No. : | NUCB1-28431TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-461 of Human Nucleobindin 1, linked to a N-terminal His tag; 45kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 274-461 a.a. |
Description : | This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 109 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVT LEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFE EELAAREAELNAKAQRLSQETEALGRSQGRLEAQKREL QQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDV PVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL |
Gene Name | NUCB1 nucleobindin 1 [ Homo sapiens ] |
Official Symbol | NUCB1 |
Synonyms | NUCB1; nucleobindin 1; nucleobindin-1; Calnuc; NUC; |
Gene ID | 4924 |
mRNA Refseq | NM_006184 |
Protein Refseq | NP_006175 |
MIM | 601323 |
Uniprot ID | Q02818 |
Chromosome Location | 19q13.33 |
Function | DNA binding; calcium ion binding; |
◆ Recombinant Proteins | ||
NUCB1-2052HFL | Recombinant Full Length Human NUCB1 Protein, C-Flag-tagged | +Inquiry |
NUCB1-4405Z | Recombinant Zebrafish NUCB1 | +Inquiry |
NUCB1-1394H | Recombinant Human NUCB1, His-tagged | +Inquiry |
NUCB1-3770R | Recombinant Rat NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUCB1-6074H | Recombinant Human NUCB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUCB1-3659HCL | Recombinant Human NUCB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUCB1 Products
Required fields are marked with *
My Review for All NUCB1 Products
Required fields are marked with *