Recombinant Human NUCB1, His-tagged
| Cat.No. : | NUCB1-28431TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 274-461 of Human Nucleobindin 1, linked to a N-terminal His tag; 45kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 274-461 a.a. |
| Description : | This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. |
| Conjugation : | HIS |
| Form : | Lyophilised:reconstitution with 109 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVT LEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFE EELAAREAELNAKAQRLSQETEALGRSQGRLEAQKREL QQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDV PVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL |
| Gene Name | NUCB1 nucleobindin 1 [ Homo sapiens ] |
| Official Symbol | NUCB1 |
| Synonyms | NUCB1; nucleobindin 1; nucleobindin-1; Calnuc; NUC; |
| Gene ID | 4924 |
| mRNA Refseq | NM_006184 |
| Protein Refseq | NP_006175 |
| MIM | 601323 |
| Uniprot ID | Q02818 |
| Chromosome Location | 19q13.33 |
| Function | DNA binding; calcium ion binding; |
| ◆ Recombinant Proteins | ||
| NUCB1-4109R | Recombinant Rat NUCB1 Protein | +Inquiry |
| NUCB1-10955M | Recombinant Mouse NUCB1 Protein | +Inquiry |
| NUCB1-1394H | Recombinant Human NUCB1, His-tagged | +Inquiry |
| NUCB1-4748H | Recombinant Human NUCB1 Protein (Glu37-Leu461), N-His tagged | +Inquiry |
| NUCB1-4405Z | Recombinant Zebrafish NUCB1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUCB1-3659HCL | Recombinant Human NUCB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUCB1 Products
Required fields are marked with *
My Review for All NUCB1 Products
Required fields are marked with *
