Recombinant Human NUDT1 protein, GST-tagged

Cat.No. : NUDT1-7544H
Product Overview : Recombinant Human NUDT1 protein(1-179 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-179 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol NUDT1
Synonyms NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1;
Gene ID 4521
mRNA Refseq NM_002452
Protein Refseq NP_002443
MIM 600312
UniProt ID P36639

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT1 Products

Required fields are marked with *

My Review for All NUDT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon