Recombinant Human NUDT1 protein, GST-tagged
Cat.No. : | NUDT1-7544H |
Product Overview : | Recombinant Human NUDT1 protein(1-179 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-179 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | NUDT1 |
Synonyms | NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1; |
Gene ID | 4521 |
mRNA Refseq | NM_002452 |
Protein Refseq | NP_002443 |
MIM | 600312 |
UniProt ID | P36639 |
◆ Recombinant Proteins | ||
NUDT1-3605H | Recombinant Human NUDT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT1-0799H | Recombinant Human NUDT1 Protein (Y2-V197), His tagged | +Inquiry |
NUDT1-4114R | Recombinant Rat NUDT1 Protein | +Inquiry |
NUDT1-10961M | Recombinant Mouse NUDT1 Protein | +Inquiry |
NUDT1-0798H | Recombinant Human NUDT1 Protein (Y2-V197), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT1-3655HCL | Recombinant Human NUDT1 293 Cell Lysate | +Inquiry |
NUDT1-3656HCL | Recombinant Human NUDT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT1 Products
Required fields are marked with *
My Review for All NUDT1 Products
Required fields are marked with *